Motif Alignment and Search Tool (MAST)

For further information on how to interpret these results or to get a copy of the MEME software please access http://meme.nbcr.net.

Inputs   |   Search Results   |   Program information   |   Documentation

Inputs

Top

Sequence Databases

The following sequence database was supplied to mast.

Database Sequence Count Residue Count Last Modified
swissprot 1867174 649679671 Mon May 3 14:10:04 2010
Total 1867174 649679671  

Motifs

The following motifs were supplied to mast from "motifs" last modified on Wed May 12 09:02:01 2010.

      Similarity
Motif Width Best possible match Motif 1 Motif 2 Motif 3 Motif 4 Motif 5 Motif 6 Motif 7 Motif 8 Motif 9 Motif 10 Motif 11 Motif 12 Motif 13 Motif 14 Motif 15 Motif 16 Motif 17 Motif 18 Motif 19 Motif 20 Motif 21 Motif 22 Motif 23 Motif 24 Motif 25 Motif 26 Motif 27 Motif 28 Motif 29 Motif 30 Motif 31 Motif 32 Motif 33 Motif 34 Motif 35 Motif 36 Motif 37 Motif 38 Motif 39 Motif 40 Motif 41 Motif 42 Motif 43 Motif 44 Motif 45 Motif 46 Motif 47 Motif 48 Motif 49 Motif 50
1 50 GNIPPGTVVDTKICHPTEFDFYLCSHAGMQGTSRPTHYHVLWDENNFTAD - 0.14 0.27 0.16 0.16 0.19 0.14 0.20 0.26 0.23 0.19 0.13 0.19 0.13 0.14 0.23 0.22 0.16 0.14 0.21 0.19 0.16 0.16 0.22 0.23 0.24 0.22 0.16 0.19 0.19 0.15 0.14 0.21 0.17 0.23 0.20 0.19 0.17 0.25 0.29 0.22 0.14 0.14 0.19 0.11 0.30 0.28 0.11 0.23 0.30
2 33 ELQTLTNNLCYTYARCTRSVSIVPPAYYAHLAA 0.14 - 0.23 0.19 0.13 0.19 0.17 0.21 0.15 0.19 0.17 0.18 0.22 0.16 0.15 0.27 0.24 0.24 0.15 0.14 0.15 0.16 0.11 0.31 0.20 0.22 0.24 0.15 0.19 0.18 0.15 0.13 0.26 0.12 0.19 0.27 0.13 0.16 0.14 0.41 0.23 0.11 0.06 0.23 0.14 0.20 0.16 0.24 0.13 0.29
3 25 PTIIFGMDVTHPHPGEDSSPSIAAV 0.27 0.23 - 0.12 0.10 0.20 0.14 0.17 0.13 0.10 0.19 0.15 0.30 0.12 0.13 0.17 0.20 0.14 0.17 0.19 0.18 0.21 0.11 0.17 0.17 0.21 0.20 0.15 0.19 0.11 0.15 0.13 0.23 0.17 0.19 0.21 0.15 0.30 0.20 0.36 0.18 0.20 0.09 0.09 0.17 0.25 0.11 0.19 0.27 0.24
4 26 DWPEVTKYAALVCAQAHRQEMIQDLF 0.16 0.19 0.12 - 0.13 0.15 0.14 0.18 0.16 0.24 0.11 0.13 0.16 0.15 0.14 0.18 0.24 0.26 0.18 0.19 0.19 0.24 0.18 0.22 0.23 0.13 0.19 0.21 0.18 0.14 0.27 0.25 0.22 0.11 0.17 0.16 0.11 0.15 0.20 0.37 0.18 0.17 0.10 0.13 0.19 0.18 0.17 0.19 0.31 0.22
5 24 DGVSEGQFYQVLNYELDAIRKACA 0.16 0.13 0.10 0.13 - 0.18 0.17 0.10 0.13 0.16 0.15 0.15 0.14 0.24 0.16 0.27 0.22 0.31 0.23 0.15 0.15 0.29 0.21 0.17 0.32 0.22 0.26 0.21 0.21 0.15 0.17 0.21 0.37 0.15 0.11 0.27 0.12 0.15 0.19 0.29 0.25 0.13 0.10 0.22 0.20 0.17 0.25 0.18 0.23 0.22
6 27 GFYQSFRPTQMGLSLNIDMSTTMFIEP 0.19 0.19 0.20 0.15 0.18 - 0.22 0.14 0.16 0.17 0.21 0.14 0.19 0.14 0.21 0.22 0.26 0.25 0.16 0.17 0.21 0.22 0.12 0.28 0.23 0.18 0.19 0.14 0.24 0.19 0.28 0.15 0.22 0.10 0.22 0.16 0.19 0.17 0.18 0.37 0.22 0.13 0.09 0.18 0.19 0.17 0.22 0.16 0.15 0.26
7 29 KMNDQYLANVALKINAKMGGRNTVLVDAL 0.14 0.17 0.14 0.14 0.17 0.22 - 0.14 0.19 0.23 0.13 0.22 0.26 0.16 0.14 0.28 0.23 0.26 0.25 0.30 0.29 0.17 0.17 0.20 0.31 0.23 0.17 0.13 0.22 0.18 0.18 0.17 0.25 0.13 0.15 0.15 0.18 0.16 0.23 0.40 0.22 0.11 0.09 0.27 0.21 0.22 0.14 0.17 0.15 0.31
8 21 NWQPPVTFIVVQKRHHTRLFP 0.20 0.21 0.17 0.18 0.10 0.14 0.14 - 0.14 0.13 0.21 0.16 0.17 0.21 0.10 0.21 0.25 0.16 0.24 0.21 0.20 0.23 0.16 0.18 0.12 0.36 0.23 0.18 0.19 0.12 0.21 0.13 0.16 0.18 0.11 0.17 0.12 0.13 0.15 0.30 0.16 0.18 0.05 0.21 0.15 0.18 0.21 0.16 0.15 0.11
9 27 PQNGQWNMMNKKMVNGGTVERWACINF 0.26 0.15 0.13 0.16 0.13 0.16 0.19 0.14 - 0.21 0.17 0.21 0.21 0.18 0.20 0.13 0.20 0.20 0.22 0.25 0.18 0.20 0.12 0.19 0.31 0.16 0.18 0.21 0.21 0.22 0.25 0.12 0.27 0.12 0.16 0.15 0.23 0.13 0.35 0.32 0.29 0.19 0.12 0.21 0.23 0.22 0.27 0.17 0.26 0.32
10 18 YGDWKWICETDLGIVTQC 0.23 0.19 0.10 0.24 0.16 0.17 0.23 0.13 0.21 - 0.18 0.17 0.14 0.28 0.13 0.20 0.15 0.20 0.18 0.20 0.12 0.14 0.14 0.14 0.21 0.19 0.17 0.17 0.17 0.24 0.14 0.14 0.27 0.12 0.15 0.12 0.22 0.20 0.22 0.48 0.18 0.16 0.05 0.14 0.19 0.14 0.18 0.24 0.19 0.25
11 21 RPNYLPMELCKIVEGQRYTKR 0.19 0.17 0.19 0.11 0.15 0.21 0.13 0.21 0.17 0.18 - 0.18 0.22 0.18 0.18 0.18 0.19 0.18 0.20 0.18 0.16 0.24 0.16 0.30 0.18 0.16 0.20 0.16 0.20 0.20 0.22 0.15 0.27 0.08 0.12 0.20 0.09 0.17 0.09 0.23 0.22 0.07 0.09 0.20 0.13 0.14 0.21 0.22 0.13 0.16
12 29 YAKEFGISISEKMTQVEARVLPAPWLKYH 0.13 0.18 0.15 0.13 0.15 0.14 0.22 0.16 0.21 0.17 0.18 - 0.20 0.16 0.18 0.31 0.24 0.31 0.25 0.14 0.21 0.26 0.19 0.28 0.25 0.18 0.27 0.15 0.23 0.21 0.27 0.17 0.31 0.25 0.19 0.23 0.26 0.19 0.16 0.44 0.24 0.14 0.09 0.29 0.29 0.19 0.28 0.18 0.23 0.23
13 15 AYDGRKSLYTAGPLP 0.19 0.22 0.30 0.16 0.14 0.19 0.26 0.17 0.21 0.14 0.22 0.20 - 0.26 0.15 0.18 0.13 0.19 0.19 0.19 0.12 0.15 0.22 0.20 0.16 0.15 0.18 0.14 0.14 0.24 0.17 0.19 0.16 0.18 0.16 0.13 0.25 0.32 0.23 0.29 0.18 0.13 0.11 0.14 0.22 0.18 0.24 0.22 0.23 0.19
14 27 FKVEIKFAAKADMHHLAQFLAGRQADA 0.13 0.16 0.12 0.15 0.24 0.14 0.16 0.21 0.18 0.28 0.18 0.16 0.26 - 0.24 0.29 0.24 0.35 0.16 0.19 0.17 0.24 0.25 0.20 0.22 0.23 0.19 0.17 0.29 0.17 0.21 0.23 0.31 0.19 0.24 0.24 0.26 0.17 0.24 0.53 0.23 0.14 0.11 0.19 0.17 0.15 0.18 0.14 0.39 0.31
15 21 VEYFWEMYGYTIQHTHWPCLQ 0.14 0.15 0.13 0.14 0.16 0.21 0.14 0.10 0.20 0.13 0.18 0.18 0.15 0.24 - 0.19 0.19 0.19 0.20 0.15 0.16 0.13 0.15 0.17 0.15 0.16 0.17 0.24 0.30 0.15 0.24 0.21 0.20 0.22 0.14 0.16 0.32 0.14 0.26 0.30 0.24 0.10 0.04 0.16 0.21 0.18 0.17 0.17 0.19 0.42
16 15 LPALHENVKNVMFYC 0.23 0.27 0.17 0.18 0.27 0.22 0.28 0.21 0.13 0.20 0.18 0.31 0.18 0.29 0.19 - 0.22 0.33 0.30 0.19 0.29 0.15 0.30 0.16 0.16 0.26 0.14 0.16 0.15 0.25 0.15 0.28 0.37 0.20 0.17 0.23 0.18 0.21 0.21 0.28 0.14 0.08 0.01 0.38 0.21 0.19 0.27 0.26 0.27 0.24
17 15 QEALQVLDIVLREHP 0.22 0.24 0.20 0.24 0.22 0.26 0.23 0.25 0.20 0.15 0.19 0.24 0.13 0.24 0.19 0.22 - 0.30 0.27 0.22 0.12 0.23 0.26 0.16 0.21 0.29 0.18 0.17 0.23 0.22 0.11 0.22 0.22 0.16 0.19 0.22 0.23 0.19 0.15 0.27 0.16 0.06 0.02 0.28 0.25 0.23 0.17 0.27 0.23 0.15
18 17 DWVKIKKALKNVKVEVT 0.16 0.24 0.14 0.26 0.31 0.25 0.26 0.16 0.20 0.20 0.18 0.31 0.19 0.35 0.19 0.33 0.30 - 0.31 0.26 0.22 0.21 0.21 0.28 0.28 0.16 0.19 0.23 0.27 0.24 0.13 0.33 0.44 0.23 0.16 0.24 0.19 0.16 0.22 0.29 0.15 0.27 0.01 0.27 0.30 0.23 0.23 0.24 0.21 0.18
19 50 NVQESVARGFCHELAQMCQISGMEFNPEPVIPIYSARPDQVEKALKHVYH 0.14 0.15 0.17 0.18 0.23 0.16 0.25 0.24 0.22 0.18 0.20 0.25 0.19 0.16 0.20 0.30 0.27 0.31 - 0.21 0.22 0.24 0.18 0.21 0.32 0.31 0.19 0.16 0.25 0.32 0.22 0.21 0.34 0.15 0.22 0.27 0.25 0.14 0.30 0.31 0.24 0.21 0.06 0.43 0.19 0.19 0.33 0.18 0.26 0.27
20 29 PDKDLHHYDVTITPEVTSRGVNRAIMAEL 0.21 0.14 0.19 0.19 0.15 0.17 0.30 0.21 0.25 0.20 0.18 0.14 0.19 0.19 0.15 0.19 0.22 0.26 0.21 - 0.21 0.16 0.19 0.21 0.33 0.15 0.19 0.29 0.17 0.17 0.19 0.15 0.22 0.16 0.12 0.18 0.17 0.16 0.22 0.32 0.17 0.13 0.04 0.17 0.33 0.22 0.19 0.18 0.26 0.28
21 15 RKATGQKPQRIIFYR 0.19 0.15 0.18 0.19 0.15 0.21 0.29 0.20 0.18 0.12 0.16 0.21 0.12 0.17 0.16 0.29 0.12 0.22 0.22 0.21 - 0.28 0.25 0.16 0.21 0.17 0.21 0.24 0.11 0.21 0.16 0.19 0.32 0.19 0.16 0.12 0.11 0.13 0.24 0.27 0.24 0.18 0.12 0.23 0.21 0.18 0.32 0.17 0.24 0.17
22 16 QITALLKMTCQRPQER 0.16 0.16 0.21 0.24 0.29 0.22 0.17 0.23 0.20 0.14 0.24 0.26 0.15 0.24 0.13 0.15 0.23 0.21 0.24 0.16 0.28 - 0.33 0.16 0.17 0.18 0.14 0.21 0.21 0.27 0.09 0.26 0.30 0.20 0.18 0.26 0.14 0.24 0.26 0.35 0.18 0.20 0.14 0.26 0.27 0.21 0.34 0.23 0.31 0.15
23 29 NMNQKYRITGLTEQPCRELWFPMDDKNTM 0.16 0.11 0.11 0.18 0.21 0.12 0.17 0.16 0.12 0.14 0.16 0.19 0.22 0.25 0.15 0.30 0.26 0.21 0.18 0.19 0.25 0.33 - 0.20 0.21 0.30 0.20 0.18 0.22 0.20 0.18 0.21 0.26 0.24 0.23 0.20 0.18 0.13 0.23 0.36 0.34 0.15 0.10 0.18 0.23 0.19 0.20 0.16 0.30 0.29
24 15 GTKCILKANHFFVEF 0.22 0.31 0.17 0.22 0.17 0.28 0.20 0.18 0.19 0.14 0.30 0.28 0.20 0.20 0.17 0.16 0.16 0.28 0.21 0.21 0.16 0.16 0.20 - 0.20 0.12 0.27 0.18 0.27 0.17 0.20 0.24 0.21 0.14 0.20 0.14 0.26 0.15 0.18 0.37 0.18 0.20 0.06 0.21 0.25 0.18 0.17 0.30 0.23 0.16
25 15 GTVDGGMIRELLISF 0.23 0.20 0.17 0.23 0.32 0.23 0.31 0.12 0.31 0.21 0.18 0.25 0.16 0.22 0.15 0.16 0.21 0.28 0.32 0.33 0.21 0.17 0.21 0.20 - 0.15 0.22 0.24 0.30 0.27 0.15 0.22 0.24 0.16 0.15 0.12 0.17 0.17 0.20 0.29 0.19 0.26 0.10 0.21 0.34 0.21 0.13 0.21 0.37 0.14
26 15 ELQLLICILPDNNGS 0.24 0.22 0.21 0.13 0.22 0.18 0.23 0.36 0.16 0.19 0.16 0.18 0.15 0.23 0.16 0.26 0.29 0.16 0.31 0.15 0.17 0.18 0.30 0.12 0.15 - 0.12 0.17 0.26 0.19 0.14 0.22 0.18 0.36 0.20 0.25 0.10 0.15 0.16 0.36 0.11 0.15 0.10 0.13 0.23 0.29 0.14 0.25 0.14 0.18
27 15 WRCCPVGRSFFSPDM 0.22 0.24 0.20 0.19 0.26 0.19 0.17 0.23 0.18 0.17 0.20 0.27 0.18 0.19 0.17 0.14 0.18 0.19 0.19 0.19 0.21 0.14 0.20 0.27 0.22 0.12 - 0.19 0.10 0.27 0.29 0.15 0.20 0.14 0.16 0.21 0.22 0.27 0.23 0.29 0.24 0.21 0.09 0.18 0.22 0.22 0.14 0.15 0.15 0.19
28 29 FYHYSVALKYEDGRPVDGKGIGRKVIDKV 0.16 0.15 0.15 0.21 0.21 0.14 0.13 0.18 0.21 0.17 0.16 0.15 0.14 0.17 0.24 0.16 0.17 0.23 0.16 0.29 0.24 0.21 0.18 0.18 0.24 0.17 0.19 - 0.18 0.14 0.27 0.15 0.24 0.28 0.15 0.18 0.18 0.18 0.42 0.42 0.32 0.23 0.18 0.17 0.28 0.18 0.20 0.15 0.37 0.32
29 15 LPVIDFVAQNLNKDD 0.19 0.19 0.19 0.18 0.21 0.24 0.22 0.19 0.21 0.17 0.20 0.23 0.14 0.29 0.30 0.15 0.23 0.27 0.25 0.17 0.11 0.21 0.22 0.27 0.30 0.26 0.10 0.18 - 0.27 0.16 0.22 0.25 0.29 0.12 0.19 0.23 0.26 0.13 0.40 0.18 0.07 0.05 0.29 0.21 0.24 0.13 0.21 0.14 0.20
30 28 SARCDVRHLVRDLIKCGMMKGIMIEPPF 0.19 0.18 0.11 0.14 0.15 0.19 0.18 0.12 0.22 0.24 0.20 0.21 0.24 0.17 0.15 0.25 0.22 0.24 0.32 0.17 0.21 0.27 0.20 0.17 0.27 0.19 0.27 0.14 0.27 - 0.19 0.16 0.28 0.19 0.13 0.30 0.19 0.13 0.18 0.29 0.19 0.15 0.06 0.43 0.17 0.22 0.27 0.13 0.33 0.29
31 11 FRARFYMEPEM 0.15 0.15 0.15 0.27 0.17 0.28 0.18 0.21 0.25 0.14 0.22 0.27 0.17 0.21 0.24 0.15 0.11 0.13 0.22 0.19 0.16 0.09 0.18 0.20 0.15 0.14 0.29 0.27 0.16 0.19 - 0.19 0.08 0.30 0.15 0.16 0.20 0.21 0.20 0.25 0.20 0.21 0.13 0.27 0.23 0.25 0.24 0.21 0.16 0.15
32 29 FEENPQFRRAPPMVRVEKMFEQIQSKLPG 0.14 0.13 0.13 0.25 0.21 0.15 0.17 0.13 0.12 0.14 0.15 0.17 0.19 0.23 0.21 0.28 0.22 0.33 0.21 0.15 0.19 0.26 0.21 0.24 0.22 0.22 0.15 0.15 0.22 0.16 0.19 - 0.31 0.17 0.11 0.20 0.14 0.14 0.27 0.30 0.26 0.18 0.13 0.22 0.28 0.23 0.24 0.17 0.34 0.27
33 11 QDLGGGVEGWR 0.21 0.26 0.23 0.22 0.37 0.22 0.25 0.16 0.27 0.27 0.27 0.31 0.16 0.31 0.20 0.37 0.22 0.44 0.34 0.22 0.32 0.30 0.26 0.21 0.24 0.18 0.20 0.24 0.25 0.28 0.08 0.31 - 0.23 0.20 0.23 0.23 0.24 0.14 0.20 0.26 0.17 0.15 0.23 0.23 0.23 0.13 0.25 0.23 0.18
34 21 FTWKEFEITLVDEDDGTGGPR 0.17 0.12 0.17 0.11 0.15 0.10 0.13 0.18 0.12 0.12 0.08 0.25 0.18 0.19 0.22 0.20 0.16 0.23 0.15 0.16 0.19 0.20 0.24 0.14 0.16 0.36 0.14 0.28 0.29 0.19 0.30 0.17 0.23 - 0.12 0.21 0.16 0.23 0.24 0.38 0.22 0.21 0.22 0.19 0.26 0.32 0.25 0.15 0.35 0.26
35 21 QPPPASSKSLRFPLRPGFGTV 0.23 0.19 0.19 0.17 0.11 0.22 0.15 0.11 0.16 0.15 0.12 0.19 0.16 0.24 0.14 0.17 0.19 0.16 0.22 0.12 0.16 0.18 0.23 0.20 0.15 0.20 0.16 0.15 0.12 0.13 0.15 0.11 0.20 0.12 - 0.20 0.10 0.18 0.21 0.25 0.13 0.17 0.13 0.11 0.19 0.15 0.32 0.13 0.19 0.22
36 15 DILQTVHHNAYHQDP 0.20 0.27 0.21 0.16 0.27 0.16 0.15 0.17 0.15 0.12 0.20 0.23 0.13 0.24 0.16 0.23 0.22 0.24 0.27 0.18 0.12 0.26 0.20 0.14 0.12 0.25 0.21 0.18 0.19 0.30 0.16 0.20 0.23 0.21 0.20 - 0.13 0.21 0.22 0.19 0.17 0.18 0.10 0.24 0.40 0.23 0.23 0.25 0.29 0.23
37 21 YFVNHRNIELRYSGDLPCINV 0.19 0.13 0.15 0.11 0.12 0.19 0.18 0.12 0.23 0.22 0.09 0.26 0.25 0.26 0.32 0.18 0.23 0.19 0.25 0.17 0.11 0.14 0.18 0.26 0.17 0.10 0.22 0.18 0.23 0.19 0.20 0.14 0.23 0.16 0.10 0.13 - 0.18 0.30 0.32 0.30 0.13 0.12 0.16 0.18 0.19 0.22 0.10 0.25 0.36
38 29 AQMGQFMKFEDMSETSSSHGGHTSAGAVP 0.17 0.16 0.30 0.15 0.15 0.17 0.16 0.13 0.13 0.20 0.17 0.19 0.32 0.17 0.14 0.21 0.19 0.16 0.14 0.16 0.13 0.24 0.13 0.15 0.17 0.15 0.27 0.18 0.26 0.13 0.21 0.14 0.24 0.23 0.18 0.21 0.18 - 0.24 0.32 0.23 0.15 0.23 0.23 0.22 0.25 0.13 0.14 0.21 0.18
39 11 NHNDRNSTDKS 0.25 0.14 0.20 0.20 0.19 0.18 0.23 0.15 0.35 0.22 0.09 0.16 0.23 0.24 0.26 0.21 0.15 0.22 0.30 0.22 0.24 0.26 0.23 0.18 0.20 0.16 0.23 0.42 0.13 0.18 0.20 0.27 0.14 0.24 0.21 0.22 0.30 0.24 - 0.21 0.31 0.38 0.19 0.21 0.23 0.19 0.17 0.21 0.23 0.26
40 8 RIPLVSDI 0.29 0.41 0.36 0.37 0.29 0.37 0.40 0.30 0.32 0.48 0.23 0.44 0.29 0.53 0.30 0.28 0.27 0.29 0.31 0.32 0.27 0.35 0.36 0.37 0.29 0.36 0.29 0.42 0.40 0.29 0.25 0.30 0.20 0.38 0.25 0.19 0.32 0.32 0.21 - 0.23 0.29 0.06 0.36 0.32 0.28 0.13 0.45 0.12 0.20
41 11 YRESHLGMRLP 0.22 0.23 0.18 0.18 0.25 0.22 0.22 0.16 0.29 0.18 0.22 0.24 0.18 0.23 0.24 0.14 0.16 0.15 0.24 0.17 0.24 0.18 0.34 0.18 0.19 0.11 0.24 0.32 0.18 0.19 0.20 0.26 0.26 0.22 0.13 0.17 0.30 0.23 0.31 0.23 - 0.19 0.15 0.30 0.27 0.17 0.15 0.28 0.30 0.37
42 21 GNGSPNESDRKRMRRPYQSKT 0.14 0.11 0.20 0.17 0.13 0.13 0.11 0.18 0.19 0.16 0.07 0.14 0.13 0.14 0.10 0.08 0.06 0.27 0.21 0.13 0.18 0.20 0.15 0.20 0.26 0.15 0.21 0.23 0.07 0.15 0.21 0.18 0.17 0.21 0.17 0.18 0.13 0.15 0.38 0.29 0.19 - 0.26 0.09 0.18 0.13 0.29 0.20 0.28 0.25
43 15 GGGRGGGGGGRGGGG 0.14 0.06 0.09 0.10 0.10 0.09 0.09 0.05 0.12 0.05 0.09 0.09 0.11 0.11 0.04 0.01 0.02 0.01 0.06 0.04 0.12 0.14 0.10 0.06 0.10 0.10 0.09 0.18 0.05 0.06 0.13 0.13 0.15 0.22 0.13 0.10 0.12 0.23 0.19 0.06 0.15 0.26 - 0.07 0.06 0.10 0.18 0.09 0.16 0.12
44 21 FINQLIQRCCQLGIFMNKNTW 0.19 0.23 0.09 0.13 0.22 0.18 0.27 0.21 0.21 0.14 0.20 0.29 0.14 0.19 0.16 0.38 0.28 0.27 0.43 0.17 0.23 0.26 0.18 0.21 0.21 0.13 0.18 0.17 0.29 0.43 0.27 0.22 0.23 0.19 0.11 0.24 0.16 0.23 0.21 0.36 0.30 0.09 0.07 - 0.27 0.21 0.24 0.16 0.22 0.16
45 41 SSQRIFHYNVEISPNPSKEVARMIKQKLVEENSAVLSGALP 0.11 0.14 0.17 0.19 0.20 0.19 0.21 0.15 0.23 0.19 0.13 0.29 0.22 0.17 0.21 0.21 0.25 0.30 0.19 0.33 0.21 0.27 0.23 0.25 0.34 0.23 0.22 0.28 0.21 0.17 0.23 0.28 0.23 0.26 0.19 0.40 0.18 0.22 0.23 0.32 0.27 0.18 0.06 0.27 - 0.19 0.29 0.17 0.25 0.25
46 21 QNKMEFTVVLEDVSSNRNNGN 0.30 0.20 0.25 0.18 0.17 0.17 0.22 0.18 0.22 0.14 0.14 0.19 0.18 0.15 0.18 0.19 0.23 0.23 0.19 0.22 0.18 0.21 0.19 0.18 0.21 0.29 0.22 0.18 0.24 0.22 0.25 0.23 0.23 0.32 0.15 0.23 0.19 0.25 0.19 0.28 0.17 0.13 0.10 0.21 0.19 - 0.10 0.20 0.28 0.23
47 8 KTWQDPQR 0.28 0.16 0.11 0.17 0.25 0.22 0.14 0.21 0.27 0.18 0.21 0.28 0.24 0.18 0.17 0.27 0.17 0.23 0.33 0.19 0.32 0.34 0.20 0.17 0.13 0.14 0.14 0.20 0.13 0.27 0.24 0.24 0.13 0.25 0.32 0.23 0.22 0.13 0.17 0.13 0.15 0.29 0.18 0.24 0.29 0.10 - 0.18 0.18 0.13
48 29 SPQFEPTQVLNNVSLLESKLKKIHKAASN 0.11 0.24 0.19 0.19 0.18 0.16 0.17 0.16 0.17 0.24 0.22 0.18 0.22 0.14 0.17 0.26 0.27 0.24 0.18 0.18 0.17 0.23 0.16 0.30 0.21 0.25 0.15 0.15 0.21 0.13 0.21 0.17 0.25 0.15 0.13 0.25 0.10 0.14 0.21 0.45 0.28 0.20 0.09 0.16 0.17 0.20 0.18 - 0.27 0.24
49 8 DTGREKDC 0.23 0.13 0.27 0.31 0.23 0.15 0.15 0.15 0.26 0.19 0.13 0.23 0.23 0.39 0.19 0.27 0.23 0.21 0.26 0.26 0.24 0.31 0.30 0.23 0.37 0.14 0.15 0.37 0.14 0.33 0.16 0.34 0.23 0.35 0.19 0.29 0.25 0.21 0.23 0.12 0.30 0.28 0.16 0.22 0.25 0.28 0.18 0.27 - 0.20
50 11 TYDSELAGKDF 0.30 0.29 0.24 0.22 0.22 0.26 0.31 0.11 0.32 0.25 0.16 0.23 0.19 0.31 0.42 0.24 0.15 0.18 0.27 0.28 0.17 0.15 0.29 0.16 0.14 0.18 0.19 0.32 0.20 0.29 0.15 0.27 0.18 0.26 0.22 0.23 0.36 0.18 0.26 0.20 0.37 0.25 0.12 0.16 0.25 0.23 0.13 0.24 0.20 -

Search Results

Top

Top Scoring Sequences

Each of the following 187 sequences has an E-value less than 0.01.
The motif matches shown have a position p-value less than 0.01.
Click on the arrow (↧) next to the E-value to view more information about a sequence.

Motif 1
Motif 2
Motif 3
Motif 4
Motif 5
Motif 6
Motif 7
Motif 8
Motif 9
Motif 10
Motif 11
Motif 12
Motif 13
Motif 14
Motif 15
Motif 16
Motif 17
Motif 18
Motif 19
Motif 20
Motif 21
Motif 22
Motif 23
Motif 24
Motif 25
Motif 26
Motif 27
Motif 28
Motif 29
Motif 30
Motif 31
Motif 32
Motif 33
Motif 34
Motif 35
Motif 36
Motif 37
Motif 38
Motif 39
Motif 40
Motif 41
Motif 42
Motif 43
Motif 44
Motif 45
Motif 46
Motif 47
Motif 48
Motif 49
Motif 50
Sequence E-value   Block Diagram
 
0
200
400
600
800
1000
1200
gi|21280321|dbj|BAB96813.1| 0
gi|28396616|emb|CAD66636.1| 0
gi|21280323|dbj|BAB96814.1| 0
gi|15239989|ref|NP_199194.1| 0
gi|15221177|ref|NP_175274.1| 0
gi|2959781|emb|CAA11429.1| 0
gi|11386645|sp|Q9SJK3.1|AGOL_ARATH 0
gi|34395088|dbj|BAC84805.1| 0
gi|115470961|ref|NP_001059079.1| 0
gi|115450040|ref|NP_001048621.1| 0
gi|115444483|ref|NP_001046021.1| 0
gi|115447849|ref|NP_001047704.1| 0
gi|75119242|sp|Q69UP6.1|AGO18_ORYSJ 0
gi|75119312|sp|Q69VD5.1|PNH1_ORYSJ 0
gi|115470098|ref|NP_001058648.1| 0
gi|15222321|ref|NP_177103.1| 0
gi|15221662|ref|NP_174414.1| 0
sp|Q10F39|AGO11_ORYSJ 0
sp|Q7Y001|AGO12_ORYSJ 0
sp|Q852N2|AGO13_ORYSJ 0
sp|Q6Z4F1|AGO14_ORYSJ 0
sp|Q5NBN9|AGO15_ORYSJ 0
sp|Q6YSJ5|AGO16_ORYSJ 0
sp|Q6H6C3|AGO17_ORYSJ 0
sp|Q69UP6|AGO18_ORYSJ 0
sp|Q6EU14|AGO1A_ORYSJ 0
sp|Q7XSA2|AGO1B_ORYSJ 0
sp|Q6K972|AGO1C_ORYSJ 0
sp|Q5Z5B2|AGO1D_ORYSJ 0
sp|O04379|AGO1_ARATH 0
sp|Q7XTS4|AGO2_ORYSJ 0
sp|Q9SDG8|AGO4A_ORYSJ 0
sp|Q0JF58|AGO4B_ORYSJ 0
sp|Q75HC2|AGO7_ORYSJ 0
sp|Q9SJK3|AGOL_ARATH 0
sp|Q851R2|MEL1_ORYSJ 0
gi|29171734|ref|NP_036286.2| 5.7e-221
sp|Q9UKV8|AGO2_HUMAN 5.7e-221
gi|38372868|sp|Q9QZ81.2|AGO2_RAT 1e-220
sp|Q9QZ81|AGO2_RAT 1e-220
sp|Q6QME8|AGO2_BOVIN 2.6e-220
sp|Q8CJG0|AGO2_MOUSE 9.4e-220
sp|Q6DJB9|AGO2_XENTR 1.2e-217
gi|22830889|dbj|BAC15767.1| 1.2e-217
sp|Q6DCX2|AGO2_XENLA 3.4e-217
gi|38372872|sp|O77503.2|AGO2_RABIT 5.8e-216
sp|O77503|AGO2_RABIT 5.8e-216
sp|Q7XTS3|AGO3_ORYSJ 9e-214
gi|47222230|emb|CAG11109.1| 2e-212
sp|A3KPK0|AGO3_DANRE 6.8e-210
gi|29294647|ref|NP_079128.2| 8.6e-210
sp|Q9H9G7|AGO3_HUMAN 8.6e-210
sp|Q5ZLG4|AGO3_CHICK 2.2e-209
gi|17647145|ref|NP_523734.1| 2.3e-209
gi|10434450|dbj|BAB14262.1| 2.4e-209
gi|24653501|ref|NP_725341.1| 4.8e-209
gi|125808990|ref|XP_001360946.1| 1.1e-207
gi|25148113|ref|NP_510322.2| 5.8e-207
sp|Q4KLV6|AGO4_XENLA 5.8e-206
gi|47213825|emb|CAF95386.1| 1.2e-205
gi|84468316|dbj|BAE71241.1| 4.1e-205
gi|240120065|ref|NP_700451.2| 1.1e-204
gi|38372350|sp|Q8CJF9.1|AGO3_MOUSE 1.1e-204
sp|Q8CJF9|AGO3_MOUSE 1.1e-204
gi|6912352|ref|NP_036331.1| 2.5e-204
sp|Q9UL18|AGO1_HUMAN 2.5e-204
gi|268581407|ref|XP_002645687.1| 8.3e-204
gi|10047199|dbj|BAB13393.1| 1.1e-202
gi|29029593|ref|NP_060099.2| 4.6e-202
sp|Q9HCK5|AGO4_HUMAN 4.6e-202
sp|Q8CJF8|AGO4_MOUSE 9.1e-201
gi|38372352|sp|Q8CJG1.1|AGO1_MOUSE 7.9e-200
sp|Q8CJG1|AGO1_MOUSE 7.9e-200
gi|22830893|dbj|BAC15769.1| 3.2e-199
sp|Q6T5B7|AGO3_BOVIN 1.4e-196
gi|47216330|emb|CAG03367.1| 5.3e-196
gi|17531191|ref|NP_493837.1| 4.6e-192
gi|268569228|ref|XP_002648206.1| 3.5e-191
sp|Q5ZMW0|AGO4_CHICK 6.3e-185
gi|26451958|dbj|BAC43071.1| 2.9e-177
gi|47211075|emb|CAF89690.1| 2.5e-165
gi|19075282|ref|NP_587782.1| 1.7e-114
sp|O74957|AGO1_SCHPO 1.7e-114
gi|26451558|dbj|BAC42876.1| 9.4e-108
gi|17542480|ref|NP_502218.1| 7.7e-104
gi|17542482|ref|NP_502217.1| 1.6e-103
gi|17557075|ref|NP_499192.1| 5.9e-103
gi|268573304|ref|XP_002641629.1| 6.6e-103
gi|17557077|ref|NP_499191.1| 7.2e-103
gi|7019863|dbj|BAA90899.1| 6.5e-99
gi|24664664|ref|NP_648775.1| 2.4e-94
sp|Q9VUQ5|AGO2_DROME 2.4e-94
gi|58259803|ref|XP_567314.1| 3.3e-94
gi|24664668|ref|NP_730054.1| 3.5e-94
gi|58259779|ref|XP_567302.1| 7.8e-92
gi|70983606|ref|XP_747330.1| 1.3e-86
gi|85090790|ref|XP_958586.1| 2.2e-85
gi|268564781|ref|XP_002639226.1| 4.5e-83
gi|67522124|ref|XP_659123.1| 3.4e-82
gi|46105440|ref|XP_380524.1| 7e-81
gi|169766388|ref|XP_001817665.1| 1.9e-77
gi|70999602|ref|XP_754518.1| 2.6e-76
gi|116202223|ref|XP_001226923.1| 2.4e-75
gi|169770677|ref|XP_001819808.1| 3e-74
gi|46128749|ref|XP_388928.1| 8.7e-68
gi|68480922|ref|XP_715614.1| 5.9e-63
gi|169763850|ref|XP_001727825.1| 2.3e-62
gi|7248733|gb|AAF43641.1|AF217760_1 2.5e-60
gi|116179304|ref|XP_001219501.1| 1.8e-50
gi|47206043|emb|CAF94541.1| 9.4e-50
gi|268576977|ref|XP_002643470.1| 2.2e-48
gi|268529116|ref|XP_002629684.1| 1.4e-47
gi|25148583|ref|NP_503362.2| 4.6e-46
gi|25155102|ref|NP_741611.1| 1.8e-42
gi|268559358|ref|XP_002637670.1| 1.9e-42
gi|268576947|ref|XP_002643455.1| 3e-41
gi|268567025|ref|XP_002647698.1| 3.1e-41
gi|47216329|emb|CAG03366.1| 4.1e-38
gi|89266752|emb|CAJ83581.1| 1.8e-36
gi|10946610|ref|NP_067283.1| 3.6e-36
gi|24431985|ref|NP_060538.2| 5.2e-36
gi|66824181|ref|XP_645445.1| 7.8e-36
gi|73990911|emb|CAJ28986.1| 1.3e-33
gi|66819117|ref|XP_643218.1| 2.4e-33
gi|10946612|ref|NP_067286.1| 6.6e-33
gi|17136494|ref|NP_476734.1| 3.6e-31
gi|14042216|dbj|BAB55155.1| 3.6e-31
gi|34330158|ref|NP_899181.1| 7e-31
gi|33411134|dbj|BAC81343.1| 2.5e-30
gi|47227681|emb|CAG09678.1| 1.5e-29
gi|268563508|ref|XP_002646953.1| 2.4e-29
gi|7022327|dbj|BAA91558.1| 3.1e-29
gi|17508571|ref|NP_492045.1| 5e-29
sp|Q21770|GCC7_CAEEL 5e-29
gi|66803755|ref|XP_635708.1| 5e-29
gi|268556282|ref|XP_002636130.1| 1.7e-28
gi|74201174|dbj|BAE37436.1| 3.2e-28
gi|47212924|emb|CAF90296.1| 3.6e-28
gi|17552216|ref|NP_497834.1| 7.7e-28
gi|33411130|dbj|BAC81341.1| 1.2e-26
gi|268560624|ref|XP_002646253.1| 1.4e-25
gi|17136736|ref|NP_476875.1| 5.1e-25
gi|40782211|emb|CAE45021.1| 2.9e-24
gi|90101431|sp|Q2Q5Y9.1|PIWI1_SCHMD 9.7e-23
gi|17569229|ref|NP_508092.1| 2e-21
gi|268564624|ref|XP_002639166.1| 4.3e-21
gi|268552771|ref|XP_002634368.1| 4.2e-20
gi|14042739|dbj|BAB55374.1| 6.6e-20
gi|145538706|ref|XP_001455053.1| 7.8e-20
gi|268560308|ref|XP_002646180.1| 2.5e-19
gi|66805111|ref|XP_636288.1| 6.8e-19
gi|268566005|ref|XP_002639608.1| 8.5e-19
gi|268557902|ref|XP_002636941.1| 1.1e-18
gi|74830543|emb|CAI39067.1| 1.9e-18
gi|90101432|sp|Q2Q5Y8.1|PIWI2_SCHMD 5.7e-18
gi|21671127|dbj|BAC02573.1| 1.3e-16
gi|268530092|ref|XP_002630172.1| 1.5e-16
gi|90101433|sp|Q2PC95.1|PIWIL_DUGJA 3e-16
gi|7495470|pir||T18974 4.2e-16
gi|47212921|emb|CAF90293.1| 9.5e-16
gi|6630673|dbj|BAA88525.1| 1.4e-15
gi|74834173|emb|CAI44470.1| 2.3e-15
gi|74830538|emb|CAI39066.1| 2.5e-15
gi|67537446|ref|XP_662497.1| 6.3e-15
gi|47197079|emb|CAF88440.1| 1.5e-14
gi|268577867|ref|XP_002643916.1| 1.7e-13
gi|145509146|ref|XP_001440517.1| 1.8e-13
gi|74830577|emb|CAI39074.1| 2.2e-13
gi|145535820|ref|XP_001453643.1| 2.3e-13
gi|268565537|ref|XP_002647350.1| 1e-12
gi|67482329|ref|XP_656514.1| 1.2e-12
gi|40889580|pdb|1R4K|A 6.7e-12
gi|67482173|ref|XP_656436.1| 9.8e-12
gi|145533507|ref|XP_001452498.1| 1e-11
gi|49259002|pdb|1SI2|A 1.1e-11
gi|268561152|ref|XP_002646376.1| 1.4e-11
gi|49259004|pdb|1SI3|A 3e-11
gi|145483989|ref|XP_001428017.1| 4.2e-11
gi|268558494|ref|XP_002637237.1| 4.3e-11
gi|145537658|ref|XP_001454540.1| 4.5e-11
gi|116203593|ref|XP_001227607.1| 2.5e-10
gi|145513356|ref|XP_001442589.1| 3.9e-10
gi|145520419|ref|XP_001446065.1| 4.5e-10
gi|145502474|ref|XP_001437215.1| 7.9e-10
gi|268536990|ref|XP_002633631.1| 2.8e-09
gi|268567213|ref|XP_002647743.1| 1.2e-05
gi|71748496|ref|XP_823303.1| 0.00035
Motif 1
Motif 2
Motif 3
Motif 4
Motif 5
Motif 6
Motif 7
Motif 8
Motif 9
Motif 10
Motif 11
Motif 12
Motif 13
Motif 14
Motif 15
Motif 16
Motif 17
Motif 18
Motif 19
Motif 20
Motif 21
Motif 22
Motif 23
Motif 24
Motif 25
Motif 26
Motif 27
Motif 28
Motif 29
Motif 30
Motif 31
Motif 32
Motif 33
Motif 34
Motif 35
Motif 36
Motif 37
Motif 38
Motif 39
Motif 40
Motif 41
Motif 42
Motif 43
Motif 44
Motif 45
Motif 46
Motif 47
Motif 48
Motif 49
Motif 50
Top
MAST version
4.4.0 (Release date: Tue Apr 27 10:09:30 EST 2010)
Reference
Timothy L. Bailey and Michael Gribskov,
"Combining evidence using p-values: application to sequence homology searches", Bioinformatics, 14(48-54), 1998.
Command line summary

Background letter frequencies (from ):
A: NaN   C: NaN   D: NaN   E: NaN   F: NaN   G: NaN   H: NaN   I: NaN   K: NaN   L: NaN   M: NaN   N: NaN   P: NaN   Q: NaN   R: NaN   S: NaN   T: NaN   V: NaN   W: NaN   Y: NaN

Result calculation took 7167.610 seconds
show model parameters...

Explanation of MAST Results

Top

The MAST results consist of

Inputs

MAST received the following inputs.

Sequence Databases

This table summarises the sequence databases specified to MAST.

Database
The name of the database file.
Sequence Count
The number of sequences in the database.
Residue Count
The number of residues in the database.
Motifs

Summary of the motifs specified to MAST.

Name
The name of the motif. If the motif has been removed or removal is recommended to avoid highly similar motifs then it will be displayed in red text.
Width
The width of the motif. No gaps are allowed in motifs supplied to MAST as it only works for motifs of a fixed width.
Best possible match
The sequence that would achieve the best possible match score and its reverse complement for nucleotide motifs.
Similarity
MAST computes the pairwise correlations between each pair of motifs. The correlation between two motifs is the maximum sum of Pearson's correlation coefficients for aligned columns divided by the width of the shorter motif. The maximum is found by trying all alignments of the two motifs. Motifs with correlations below 0.60 have little effect on the accuracy of the combined scores. Pairs of motifs with higher correlations should be removed from the query. Correlations above the supplied threshold are shown in red text.
Nominal Order and Spacing

This diagram shows the normal spacing of the motifs specified to MAST.

Search Results

MAST provides the following motif search results.

Top Scoring Sequences

This table summarises the top scoring sequences with a Sequence E-value better than the threshold (default 10). The sequences are sorted by the Sequence E-value from most to least significant.

Sequence
The name of the sequence. This maybe be linked to search a sequence database for the sequence name.
E-value
The E-value of the sequence. For DNA only; if strands were scored seperately then there will be two E-values for the sequence seperated by a "/". The score for the provided sequence will be first and the score for the reverse-complement will be second.
Click on this to show additional information about the sequence such as a description, combined p-value and the annotated sequence.
Block Diagram
The block diagram shows the best non-overlapping tiling of motif matches on the sequence.
  • The length of the line shows the length of a sequence relative to all the other sequences.
  • A block is shown where the positional p-value of a motif is less (more significant) than the significance threshold which is 0.0001 by default.
  • If a significant motif match (as specified above) overlaps other significant motif matches then it is only displayed as a block if its positional p-value is less (more significant) then the product of the positional p-values of the significant matches that it overlaps.
  • The position of a block shows where a motif has matched the sequence.
  • The width of a block shows the width of the motif relative to the length of the sequence.
  • The colour and border of a block identifies the matching motif as in the legend.
  • The height of a block gives an indication of the significance of the match as taller blocks are more significant. The height is calculated to be proportional to the negative logarithm of the positional p-value, truncated at the height for a p-value of 1e-10.
  • Hovering the mouse cursor over the block causes the display of the motif name and other details in the hovering text.
  • DNA only; blocks displayed above the line are a match on the given DNA, whereas blocks displayed below the line are matches to the reverse-complement of the given DNA.
  • DNA only; when strands are scored separately then blocks may overlap on opposing strands.
Additional Sequence Information

Clicking on the ↧ link expands a box below the sequence with additional information and adds two dragable buttons below the block diagram.

Description
The description appearing after the identifier in the fasta file used to specify the sequence.
Combined p-value
The combined p-value of the sequence. DNA only; if strands were scored seperately then there will be two p-values for the sequence seperated by a "/". The score for the provided sequence will be first and the score for the reverse-complement will be second.
Annotated Sequence
The annotated sequence shows a portion of the sequence with the matching motif sequences displayed above. The displayed portion of the sequence can be modified by sliding the two buttons below the sequence block diagram so that the portion you want to see is between the two needles attached to the buttons. By default the two buttons move together but you can drag one individually by holding shift before you start the drag. If the strands were scored seperately then they can't be both displayed at once due to overlaps and so a radio button offers the choice of strand to display.

Scoring

MAST scores sequences using the following measures.

Position score calculation

The score for the match of a position in a sequence to a motif is computed by by summing the appropriate entry from each column of the position-dependent scoring matrix that represents the motif. Sequences shorter than one or more of the motifs are skipped.

Position p-value

The position p-value of a match is the probability of a single random subsequence of the length of the motif scoring at least as well as the observed match.

Sequence p-value

The sequence p-value of a score is defined as the probability of a random sequence of the same length containing some match with as good or better a score.

Combined p-value

The combined p-value of a sequence measures the strength of the match of the sequence to all the motifs and is calculated by

  1. finding the score of the single best match of each motif to the sequence (best matches may overlap),
  2. calculating the sequence p-value of each score,
  3. forming the product of the p-values,
  4. taking the p-value of the product.
Sequence E-value

The E-value of a sequence is the expected number of sequences in a random database of the same size that would match the motifs as well as the sequence does and is equal to the combined p-value of the sequence times the number of sequences in the database.